PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25149.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 285aa    MW: 32987.6 Da    PI: 6.1784
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25149.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.2e-192168148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd ll+++++++G g+W++ a++ g++Rt+k+c++rw++yl
  mrna25149.1-v1.0-hybrid 21 RGPWTLEEDTLLIQYIARHGEGRWNLLANRAGLRRTGKSCRLRWLNYL 68
                             89********************************************97 PP

2Myb_DNA-binding52.98.6e-1774117146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T+eE++ ++d++ ++G++ W++Ia++++ gRt++++k++w++
  mrna25149.1-v1.0-hybrid  74 RGNLTPEEQLMILDLHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.7011672IPR017930Myb domain
SuperFamilySSF466891.65E-3119115IPR009057Homeodomain-like
SMARTSM007173.8E-162070IPR001005SANT/Myb domain
PfamPF002496.5E-182168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-232275IPR009057Homeodomain-like
CDDcd001674.52E-122368No hitNo description
PROSITE patternPS0017503645IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
SMARTSM007175.3E-1573121IPR001005SANT/Myb domain
PROSITE profilePS5129420.61573123IPR017930Myb domain
PfamPF002492.3E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-2476122IPR009057Homeodomain-like
CDDcd001672.62E-1178117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSTNTKSFSS SSSEDDNELR RGPWTLEEDT LLIQYIARHG EGRWNLLANR AGLRRTGKSC  60
RLRWLNYLKP DVKRGNLTPE EQLMILDLHS KWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KQARHLKIDT NSTEFQNIIR CFWMPRLLQK IGDQNQLASS HQHSITAPSP QLQFTHEQGA  180
VNMSGYEYNL DIEKQNTECI LPSELPMETP NTSQFSEYHT SSPFGGAMVH NDHNVYTNDH  240
DMEVSNFGNS AAAESYYVPE SESNWLETDF SCSMWNMDEL LQRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26181304110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300516.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE15e-65MY108_ARATH; Transcription factor MYB108
TrEMBLM5WA271e-130M5WA27_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g03560.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.19e-80myb domain protein 62